PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00782.1.g00330.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 547aa    MW: 59072.5 Da    PI: 10.9302
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00782.1.g00330.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.79.4e-19341395256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++k+q  +Le++F+++++++ +++  LA++lgL  rqV vWFqNrRa+ k
  Zpz_sc00782.1.g00330.1.am.mk 341 RKKLRLSKDQAAVLEDCFKRHSTLNPKQKLALANRLGLRPRQVEVWFQNRRARTK 395
                                   678899***********************************************98 PP

2HD-ZIP_I/II122.61.9e-39341429189
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlsk+q+++LE++F+++++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rLe
  Zpz_sc00782.1.g00330.1.am.mk 341 RKKLRLSKDQAAVLEDCFKRHSTLNPKQKLALANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCERLADENKRLE 421
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLre 89 
                                   ke ++L++
  Zpz_sc00782.1.g00330.1.am.mk 422 KELADLKA 429
                                   ****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-17329391IPR009057Homeodomain-like
PROSITE profilePS5007116.552337397IPR001356Homeobox domain
SMARTSM003891.2E-16339401IPR001356Homeobox domain
SuperFamilySSF466899.61E-18339406IPR009057Homeodomain-like
CDDcd000862.76E-15341398No hitNo description
PfamPF000464.1E-16341395IPR001356Homeobox domain
PROSITE patternPS000270372395IPR017970Homeobox, conserved site
SMARTSM003402.8E-16397440IPR003106Leucine zipper, homeobox-associated
PfamPF021834.3E-9397429IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MTTRTIVQLR IDLTTPQPGG GRARLLLRRK RMKLPAGETD YSSLELLTDA PLAFTLDAGC  60
SRNQVDGVRS YENAHDHHRK EGRKEGGIVA STRAAHGSSP GDSYRTTEEE QVNNQPPMGL  120
VVGGRRGPAN NSSDLASAGV GSERAPLPND CGRVVGERAG KARRTAGPWA IPVSLPFFSL  180
PFRVGPPRLR GDGLFVILLG RSGMFTIHSP SIIIVLSWPR ACMRIKFTPK DTTASCRSVA  240
FIGIIYQRAL DRSGAARQRT MRHELVSRSI GDARRDQART ADPADQGTRR PSTSPDSSAA  300
LSSGDSGSNK RERDRELERT GSVNGVRGGA GSDEEDGAGG RKKLRLSKDQ AAVLEDCFKR  360
HSTLNPKQKL ALANRLGLRP RQVEVWFQNR RARTKLKQTE VDCEYLKRWC ERLADENKRL  420
EKELADLKAA PSPVAAATQR SSAAAAFTMC PSCRRVASTA GAGTQHQQQQ CHPKSNTAAV  480
AGNVRPSHCQ FFPAAVDRTP GQSTWNAAAA APLTSPPTPA FLRSRLTAGD AGSQALGHGH  540
IQSHDQG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1389397RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0932881e-115FP093288.1 Phyllostachys edulis cDNA clone: bphylf053m07, full insert sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-47homeobox from Arabidopsis thaliana